PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr025360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 275aa    MW: 31056.7 Da    PI: 5.0541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr025360.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +lv +++q+G g+W++ ++  g+ R++k+c++rw +yl
      Pbr025360.1 14 KGIWTPEEDHILVTYIEQHGHGNWRALPKLAGLSRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding50.25.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W+ Ia++++ gRt++++k+ w+++l
      Pbr025360.1  67 RGNFSKEEEDEIINLHQILGNR-WSQIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.826961IPR017930Myb domain
SuperFamilySSF466892.9E-3110108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001679.32E-111761No hitNo description
PROSITE profilePS5129425.5562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665117IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002491.4E-1467112IPR001005SANT/Myb domain
CDDcd001679.03E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MVRAPCCAKM GLKKGIWTPE EDHILVTYIE QHGHGNWRAL PKLAGLSRCG KSCRLRWTNY  60
LRPDIKRGNF SKEEEDEIIN LHQILGNRWS QIAARLPGRT DNEIKNVWHT HLKKKLKSNQ  120
TEPDSNPYFY SIKMEQELDP VADSSHCAKS ESLDCRPVSP SQCTSSGTSS VTTGDNYNNN  180
NYACMKFDDY QTTLPVADDS FWSEVLSAGN SDEIVNEFQA FGGDPRVNVG PTDGGFSLDM  240
YNDNNMDFWF NNFLGAEEIP ELLEFDMSIR KAVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ8601348e-59FJ860134.1 Prunus persica isolate pkMYB1 myb transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009354945.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM5VU411e-127M5VU41_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s24550.12e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-74myb domain protein 15